Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Warm Goat Cheese Toast Salad

Crispy baguette topped with melted goat cheese, served over peppery greens with a bright Dijon vinaigrette. Restaurant-simple and ready in 15 minutes.

Total time
15 min
Servings
2
Calories
380
Protein
12g
Warm Goat Cheese Toast Salad
elegantlightfrenchvegetariancheesecrispymeltytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk Dijon, red wine vinegar, minced shallot, 3 tbsp olive oil, salt, and pepper in a bowl.

  2. Step 2

    Arrange baguette slices on a sheet pan and toast under the broiler until light gold, 2–3 minutes.

  3. Step 3

    Spread goat cheese evenly on each warm toast. Broil 1–2 minutes until edges bubble and top just softens.

  4. Step 4

    Toss greens with half the vinaigrette. Divide between two plates.

  5. Step 5

    Arrange warm toasts over greens. Drizzle remaining vinaigrette over the salad and serve immediately.

Tools you’ll need

  • sheet pan
  • broiler
  • small bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.