Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Warm Mushroom Hummus

Creamy Lebanese-style hummus topped with sautéed mushrooms, garlic, and warm olive oil. Ready in under 15 minutes—perfect for mezze platters or as a dip.

Total time
12 min
Servings
6
Calories
285
Protein
9g
Warm Mushroom Hummus
rusticelegantlebanesevegetarianveganchickpeascreamysmooth

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Add chickpeas, tahini, lemon juice, and 1 minced garlic clove to a food processor.

  2. Step 2

    Pulse until smooth. Add water 1 tbsp at a time until you reach a silky, thick consistency.

  3. Step 3

    Season with salt and pepper. Transfer to a shallow serving bowl.

  4. Step 4

    Heat 2 tbsp olive oil in a skillet over medium-high until shimmering, about 1 minute.

  5. Step 5

    Add sliced mushrooms and remaining minced garlic. Cook 5 minutes, stirring occasionally, until mushrooms are golden and tender.

  6. Step 6

    Pour warm mushroom mixture and remaining olive oil over hummus. Drizzle with extra oil and finish with a pinch of salt.

  7. Step 7

    Serve immediately with pita bread, vegetables, or olives.

Tools you’ll need

  • food processor
  • shallow serving bowl (8–10 inch diameter)
  • 12-inch skillet
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.