Custrd is out on the App Store — Download it free →
Back to recipes

White Asparagus with Hollandaise Sauce and Smoked Salmon

Tender white asparagus topped with rich hollandaise, delicate smoked salmon, and fresh chives, served with crispy roasted potatoes for a quick and elegant meal.

Total time
25 min
Servings
2
Calories
420
Protein
18g
White Asparagus with Hollandaise Sauce and Smoked Salmon
elegantcomfortingAmericangluten-freefishtendercreamyweeknight dinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Halve the 0.5 lb baby potatoes and toss with 1 tbsp olive oil and a pinch of salt. Roast on a baking sheet until golden and tender, about 20 minutes.

  2. Step 2

    Meanwhile, trim the woody ends from 1 lb white asparagus. Bring a large pot of salted water to a boil, add asparagus, and cook until just tender when pierced with a knife, about 5-7 minutes. Drain well.

  3. Step 3

    Arrange the hot asparagus on plates, drape 4 oz smoked salmon over the top, and spoon 0.5 cup hollandaise sauce generously over everything.

  4. Step 4

    Scatter the roasted potatoes alongside, sprinkle with 2 tbsp chopped chives, and serve immediately while warm.

Tools you’ll need

  • baking sheet
  • large pot
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.