Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Min Greek Salad with Crispy Feta

Crispy-edged feta cubes meet ripe tomatoes, cucumber, and briny olives in a bright lemon-oil dressing. No cooking required — just chop, toss, and eat.

Total time
10 min
Servings
2
Calories
285
Protein
9g
10-Min Greek Salad with Crispy Feta
freshlightsimplegreekmediterraneanvegetariangluten-freecheese

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat feta cubes dry with a paper towel. Heat 1 tbsp olive oil in a skillet over medium-high until shimmering.

  2. Step 2

    Add feta and cook without stirring for 2–3 minutes until edges turn golden brown. Transfer to a plate.

  3. Step 3

    Combine tomatoes, cucumber, olives, and red onion in a large bowl. Whisk 3 tbsp lemon juice, 3 tbsp olive oil, 1 tsp oregano, salt, and pepper in a small bowl.

  4. Step 4

    Pour dressing over salad, toss gently to combine, and let sit for 2 minutes so flavors meld.

  5. Step 5

    Top with warm crispy feta cubes and drizzle with any pan oil. Serve immediately.

Tools you’ll need

  • large mixing bowl
  • small mixing bowl
  • 12-inch skillet
  • paper towels
  • chef's knife
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.