CookSnap is in beta — Get it free on TestFlight →
Back to recipes

10-Min Greek Salad with Crispy Feta

Crispy-edged feta cubes meet ripe tomatoes, cucumber, and briny olives in a bright lemon-oil dressing. No cooking required — just chop, toss, and eat.

Total time
10 min
Servings
2
Calories
285
Protein
9g
10-Min Greek Salad with Crispy Feta
freshlightsimplegreekmediterraneanvegetariangluten-freecheese

Ingredients

  • 8 oz feta cheese, cubed
  • 1 lb ripe tomatoes, cut into 1-inch chunks
  • 1 large cucumber, seeded and cut into 1-inch pieces
  • ¾ cup Kalamata olives, pitted
  • ¼ cup red onion, thinly sliced
  • 1 lemon lemon (juiced) + extra virgin olive oil + dried oregano

Instructions

  1. 1

    Pat feta cubes dry with a paper towel. Heat 1 tbsp olive oil in a skillet over medium-high until shimmering.

  2. 2

    Add feta and cook without stirring for 2–3 minutes until edges turn golden brown. Transfer to a plate.

  3. 3

    Combine tomatoes, cucumber, olives, and red onion in a large bowl. Whisk 3 tbsp lemon juice, 3 tbsp olive oil, 1 tsp oregano, salt, and pepper in a small bowl.

  4. 4

    Pour dressing over salad, toss gently to combine, and let sit for 2 minutes so flavors meld.

  5. 5

    Top with warm crispy feta cubes and drizzle with any pan oil. Serve immediately.

Tools you’ll need

  • large mixing bowl
  • small mixing bowl
  • 12-inch skillet
  • paper towels
  • chef's knife
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.