Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Feta Greek Salad

Juicy tomatoes, crisp cucumbers, and briny olives tossed with a tangy lemon dressing and topped with salty feta. A 10-minute salad that tastes like a vacation in a bowl.

Total time
10 min
Servings
2
Calories
245
Protein
7g
Crispy Feta Greek Salad
freshlightsimplegreekvegetariangluten-freecheesecrispy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut tomatoes in half lengthwise, then into thick wedges so they hold their shape.

  2. Step 2

    Cut cucumber into 1/2-inch chunks and add to a large bowl with tomatoes and olives.

  3. Step 3

    Whisk together lemon juice, olive oil, and a pinch each of salt and pepper in a small bowl.

  4. Step 4

    Pour dressing over vegetables and toss gently until coated, about 30 seconds.

  5. Step 5

    Top with feta cubes and a few grinds of black pepper. Serve immediately.

Tools you’ll need

  • chef's knife
  • cutting board
  • large bowl
  • small bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.