Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Horiatiki — Smashed Greek Salad

Juicy tomatoes, crisp cucumber, creamy feta, and briny olives tossed with a lemon-olive oil dressing and crushed red pepper. A no-cook Mediterranean classic that tastes even better when the vegetables are lightly smashed to release their juices.

Total time
10 min
Servings
2
Calories
285
Protein
8g
Horiatiki — Smashed Greek Salad
freshlightsimplegreekmediterraneanvegetariangluten-freedairy-free

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut tomatoes into rough chunks. Cut cucumber into 1-inch pieces. Place both in a large bowl.

  2. Step 2

    Add olives, red onion, and feta. Pour olive oil and lemon juice over everything.

  3. Step 3

    Sprinkle oregano and a pinch of salt and pepper over the salad.

  4. Step 4

    Gently toss with your hands or a spoon, lightly pressing to release tomato juices, about 20 seconds.

  5. Step 5

    Let sit for 2 minutes so flavors meld, then taste and adjust seasoning.

  6. Step 6

    Serve immediately with crusty bread or warm pita if desired.

Tools you’ll need

  • large mixing bowl
  • knife
  • cutting board
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.