Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Feta Horiatiki Salad

Juicy tomatoes, cool cucumbers, briny olives, and creamy feta tossed in a lemon-oregano dressing. Crisp, fresh, and ready in under 15 minutes.

Total time
15 min
Servings
2
Calories
285
Protein
8g
Crispy Feta Horiatiki Salad
freshlightsimplegreekmediterraneanvegetariangluten-freecheese

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Halve tomatoes and scoop out seeds with your fingers. Chop tomatoes into bite-sized chunks.

  2. Step 2

    Cut cucumber in half lengthwise, then chop into half-moons about 1/2 inch thick.

  3. Step 3

    Tear feta into large chunks with your hands (don't crumble). Add tomatoes, cucumber, olives, and red onion to a bowl.

  4. Step 4

    Squeeze lemon juice over the salad. Drizzle with 2 tbsp olive oil. Sprinkle oregano and a pinch of salt.

  5. Step 5

    Toss gently with your hands so feta breaks into smaller pieces and dressing coats everything.

  6. Step 6

    Serve immediately while tomatoes are juicy and feta is creamy.

Tools you’ll need

  • cutting board
  • chef's knife
  • large mixing bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.