Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

5-Minute Naan Pizza

Crispy naan topped with warm pizza sauce, melted mozzarella, and fresh basil. A personal pizza that's ready before you finish pouring a drink.

Total time
5 min
Servings
1
Calories
380
Protein
14g
5-Minute Naan Pizza
quickcasualamericanvegetariancrispymeltyweeknightsnack

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a skillet over medium-high until water flicks sizzle on the surface.

  2. Step 2

    Place naan in the skillet and cook 1 minute until the bottom starts to brown.

  3. Step 3

    Flip the naan, then spread pizza sauce evenly over the top.

  4. Step 4

    Scatter mozzarella over the sauce and cook 2 minutes until cheese melts.

  5. Step 5

    Tear basil leaves and scatter over the melted cheese, then slide onto a plate.

Tools you’ll need

  • 10-inch skillet

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.