Custrd is out on the App Store — Download it free →
Back to recipes

5-Min Naan Pizza

Crispy naan bread topped with pizza sauce, melted mozzarella, and fresh basil — ready in minutes. No oven required; just a skillet or toaster oven.

Total time
5 min
Servings
1
Calories
320
Protein
12g
5-Min Naan Pizza
casualquickamericanvegetariancrispymeltyweeknightquick

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a skillet over medium-high until water droplets sizzle on contact.

  2. Step 2

    Place naan in the skillet and toast 60 seconds until the bottom browns slightly.

  3. Step 3

    Flip the naan, then spread pizza sauce evenly across the cooked side.

  4. Step 4

    Sprinkle mozzarella over the sauce and cover the skillet for 90 seconds until cheese melts.

  5. Step 5

    Slide onto a plate, tear basil leaves over the top, and serve immediately.

Tools you’ll need

  • 10-inch skillet
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.