Back to recipes
Pesto Mozzarella Flatbread
Crispy flatbread topped with vibrant pesto, melted mozzarella, and juicy cherry tomatoes. Ready in under 10 minutes — no fuss, pure flavor.
- Total time
- 10 min
- Servings
- 2
- Calories
- 380
- Protein
- 14g
quickcasualitalianvegetariancrispymeltyweeknightflatbread
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Preheat oven to 425°F. Place flatbread on a sheet pan.
Step 2
Spread 2 tablespoons pesto evenly over each flatbread, leaving a thin border.
Step 3
Top each piece with mozzarella and cherry tomatoes, distributing evenly.
Step 4
Bake for 6-8 minutes until cheese melts and edges turn golden.
Step 5
Remove from oven and let cool 1 minute. Slice if needed and serve hot.
Tools you’ll need
- sheet pan
- oven
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
