Pesto Mozzarella Flatbread
Crispy flatbread topped with vibrant pesto, melted mozzarella, and juicy cherry tomatoes. Ready in under 10 minutes — no fuss, pure flavor.
- Total time
- 10 min
- Servings
- 2
- Calories
- 380
- Protein
- 14g

quickcasualitalianvegetariancrispymeltyweeknightflatbread
Ingredients
- 2 pieces flatbread (naan or pita works too)
- ¼ cup pesto
- 1 cup mozzarella cheese, shredded
- 1 cup cherry tomatoes, halved
Instructions
- 1
Preheat oven to 425°F. Place flatbread on a sheet pan.
- 2
Spread 2 tablespoons pesto evenly over each flatbread, leaving a thin border.
- 3
Top each piece with mozzarella and cherry tomatoes, distributing evenly.
- 4
Bake for 6-8 minutes until cheese melts and edges turn golden.
- 5
Remove from oven and let cool 1 minute. Slice if needed and serve hot.
Tools you’ll need
- sheet pan
- oven
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



