Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

30-Minute Lemon Curd Tart with Torched Meringue

Glossy lemon curd meets crispy-chewy meringue in a no-bake tart that looks restaurant-worthy but comes together in under 30 minutes. A viral-worthy dessert with minimal technique.

Total time
30 min
Servings
4
Calories
385
Protein
3g
30-Minute Lemon Curd Tart with Torched Meringue
elegantindulgentfrenchvegetariancrispycreamygooeyDessert

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix graham cracker crumbs with melted butter until evenly moistened.

  2. Step 2

    Press mixture firmly into a 9-inch tart pan or pie dish, covering bottom and sides.

  3. Step 3

    Freeze while you prepare the filling, ~5 minutes.

  4. Step 4

    Whip heavy cream to stiff peaks in a separate bowl using an electric mixer, ~3 minutes.

  5. Step 5

    Fold lemon curd gently into whipped cream until no streaks remain.

  6. Step 6

    Pour lemon filling into the frozen crust, smooth the top, and chill while making meringue.

  7. Step 7

    Beat egg whites and sugar on high speed until stiff, glossy peaks form, ~4 minutes.

  8. Step 8

    Add vanilla, beat for 15 seconds to combine.

  9. Step 9

    Spoon meringue onto lemon filling, peak it dramatically, and torch until golden brown.

  10. Step 10

    Serve immediately while meringue is still warm and crispy outside.

Tools you’ll need

  • 9-inch tart pan with removable bottom
  • electric mixer or whisk
  • two medium bowls
  • spatula
  • kitchen torch

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.