Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

5-Minute Lemon Curd Tart with Torched Meringue

Buttery store-bought tart shell meets silky lemon curd, crowned with a caramelized meringue you torch until glossy and browned. Looks restaurant-worthy, tastes tangy-sweet, and comes together in 5 minutes.

Total time
5 min
Servings
4
Calories
240
Protein
3g
5-Minute Lemon Curd Tart with Torched Meringue
elegantindulgentfrenchvegetariancreamycrispyfluffyDessert

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Spoon lemon curd into the tart shell and spread evenly to the edges.

  2. Step 2

    Whip egg whites with cream of tartar until foamy, ~30 seconds.

  3. Step 3

    Sprinkle sugar in slowly while whisking until stiff, glossy peaks form, ~2 minutes.

  4. Step 4

    Pile meringue on top of the lemon curd in peaks and swirls.

  5. Step 5

    Torch the meringue until golden brown and caramelized, ~30 seconds total, moving flame constantly.

  6. Step 6

    Sprinkle lemon zest over the top and serve immediately.

Tools you’ll need

  • hand mixer or whisk
  • kitchen torch
  • 9-inch or smaller tart pan (pre-baked shell)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.