5-Min Greek Pita Wrap
Fluffy pita stuffed with cool, crisp cucumber and tomato, then drizzled with creamy tzatziki. Perfect lunch or light dinner that comes together in minutes.
- Total time
- 5 min
- Servings
- 2
- Calories
- 185
- Protein
- 6g

lightfreshgreekvegetarianvegetariancrispycreamytender
Ingredients
- 2 pieces pita bread
- 1 whole cucumber
- 1 whole tomato
- ½ cup tzatziki
Instructions
- 1
Slice the cucumber into thin rounds and dice the tomato into bite-size pieces.
- 2
Warm the pita bread in a dry skillet over medium-high heat for 30 seconds per side until soft and pliable.
- 3
Spread 2 tbsp tzatziki inside each pita, then stuff with cucumber and tomato slices.
- 4
Serve immediately while pita is still warm.
Tools you’ll need
- cutting board
- chef's knife
- skillet
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



