Back to recipes
5-Min Greek Pita Wrap
Fluffy pita stuffed with cool, crisp cucumber and tomato, then drizzled with creamy tzatziki. Perfect lunch or light dinner that comes together in minutes.
- Total time
- 5 min
- Servings
- 2
- Calories
- 185
- Protein
- 6g
lightfreshgreekvegetarianvegetariancrispycreamytender
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Slice the cucumber into thin rounds and dice the tomato into bite-size pieces.
Step 2
Warm the pita bread in a dry skillet over medium-high heat for 30 seconds per side until soft and pliable.
Step 3
Spread 2 tbsp tzatziki inside each pita, then stuff with cucumber and tomato slices.
Step 4
Serve immediately while pita is still warm.
Tools you’ll need
- cutting board
- chef's knife
- skillet
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
