Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Falafel Wrap

Crispy store-bought falafel wrapped in soft pita with fresh vegetables, creamy tahini sauce, and bright lemon. Ready in 15 minutes with zero cooking required.

Total time
15 min
Servings
2
Calories
385
Protein
12g
Falafel Wrap
freshlightcasualmiddle-easternvegetarianveganchickpeascrispy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk tahini, lemon juice, and water in a small bowl until smooth and pourable.

  2. Step 2

    Heat falafel in a skillet or oven following package instructions until warm and crispy outside.

  3. Step 3

    Warm pita bread in the same skillet, flipping once, until soft and pliable, ~60 seconds.

  4. Step 4

    Spread tahini sauce across the inside of each pita, leaving a 1-inch border at the edges.

  5. Step 5

    Layer falafel, tomato slices, cucumber, and fresh herbs down the center of each wrap.

  6. Step 6

    Roll each wrap tightly, folding in the sides first, then rolling away from you.

  7. Step 7

    Wrap in foil or parchment to hold together. Serve immediately.

Tools you’ll need

  • small mixing bowl
  • whisk
  • 12-inch skillet or oven
  • tongs
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.