Back to recipes
10-Min Pita Pizza
Crispy pita bread topped with tangy pizza sauce and melted mozzarella, ready in minutes. The fastest pizza night—no dough-rolling required.
- Total time
- 10 min
- Servings
- 2
- Calories
- 340
- Protein
- 15g
quickcasualamericanvegetariancrispymeltyweeknightpizza
Ingredients
3 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Place pita rounds on a baking sheet.
Step 2
Spread 2 tbsp pizza sauce evenly over each pita.
Step 3
Top each with 1/2 cup mozzarella cheese.
Step 4
Broil 4 inches from heat until cheese melts and bubbles, 2–3 minutes.
Step 5
Serve hot straight from the oven.
Tools you’ll need
- baking sheet
- broiler
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
