Custrd is out on the App Store — Download it free →
Back to recipes

Amritsari Fish

Crispy spiced fried fish with a cool yogurt sauce, fresh avocado, and a squeeze of lemon. A quick and flavorful dish that's perfect for a weeknight dinner or a special snack.

Total time
20 min
Servings
2
Calories
450
Protein
35g
Amritsari Fish
comfort foodsavoryIndiangluten-freefishcrispycreamyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut the 1 lb fish into 2-inch pieces. Pat dry with paper towels. In a shallow bowl, mix 1/2 cup gram flour, 1 tsp garam masala, and 1/2 tsp salt. Add 1/4 cup water and whisk into a thick, lumpy batter.

  2. Step 2

    Heat 1/2 inch oil in a skillet over medium-high until a drop of batter sizzles immediately. Dip each fish piece into the batter, letting excess drip off, then carefully place in the hot oil. Fry in batches, not crowding the pan, until golden and crisp, about 3-4 minutes per side. Drain on paper towels.

  3. Step 3

    In a small bowl, stir together 1/2 cup yogurt and a pinch of salt. Slice the avocado and cut the lemon into wedges.

  4. Step 4

    Serve the hot fish with the yogurt sauce, avocado slices, and lemon wedges for squeezing over.

Tools you’ll need

  • skillet
  • shallow bowl
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.