Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Crispy Topfen Strudel

Buttery phyllo wrapped around sweet quark (topfen) filling with raisins and cinnamon. Baked until golden and dusted with powdered sugar—Austrian comfort in under 20 minutes.

Total time
20 min
Servings
4
Calories
285
Protein
12g
20-Min Crispy Topfen Strudel
comfortindulgentaustrianvegetarianvegetariancrispycreamyflaky

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oven to 400°F. Line a sheet pan with parchment paper.

  2. Step 2

    Mix quark, granulated sugar, cinnamon, and raisins in a bowl until combined.

  3. Step 3

    Lay one phyllo sheet on the pan. Brush lightly with melted butter, then repeat with 5 more sheets, brushing between each.

  4. Step 4

    Spread quark filling along one long edge, leaving 2 inches from the edge. Roll tightly into a log, tucking in sides.

  5. Step 5

    Brush the strudel all over with remaining melted butter. Bake 12–14 minutes until golden brown.

  6. Step 6

    Cool 2 minutes. Dust generously with powdered sugar and serve warm.

Tools you’ll need

  • sheet pan
  • parchment paper
  • medium bowl
  • pastry brush
  • oven (400°F)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.