Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Peach Strudel with Flaky Pastry

Store-bought puff pastry wrapped around spiced peaches and berries, baked until golden and crispy. A TikTok-easy Austrian classic that tastes like you spent hours but takes 10 minutes of actual work.

Total time
20 min
Servings
2
Calories
285
Protein
4g
20-Min Peach Strudel with Flaky Pastry
elegantindulgentaustrianvegetariancrispyflakytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Line a sheet pan with parchment paper.

  2. Step 2

    Toss peach slices and berries with sugar and cinnamon in a bowl until coated.

  3. Step 3

    Unroll puff pastry on the sheet pan. Arrange fruit down the center, leaving 1.5 inches on each side.

  4. Step 4

    Fold pastry edges over the fruit, overlapping slightly to create a rustic log. Brush with beaten egg.

  5. Step 5

    Bake 12-14 minutes until pastry is golden brown and crispy on all edges.

  6. Step 6

    Cool 2 minutes on the pan, then slide onto a plate and serve warm.

Tools you’ll need

  • sheet pan
  • parchment paper
  • small bowl
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.