Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Apple Strudel Sheet Pan

Buttery phyllo layers with cinnamon-sugar apples, baked until golden and served warm with a crack of ice cream. Austrian comfort in 25 minutes.

Total time
25 min
Servings
4
Calories
285
Protein
4g
Crispy Apple Strudel Sheet Pan
cozycomfortaustrianvegetariancrispyflakytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Peel and slice apples 1/4-inch thick, discarding cores.

  2. Step 2

    Toss apple slices with sugar, cinnamon, lemon juice, and raisins in a bowl.

  3. Step 3

    Brush a sheet pan with melted butter. Lay 4 phyllo sheets on the pan, brushing each with butter and a light sprinkle of breadcrumbs.

  4. Step 4

    Spread apple mixture evenly over phyllo. Top with remaining 4 phyllo sheets, brushing each with butter.

  5. Step 5

    Bake 18–20 minutes until phyllo is golden brown and edges crackle.

  6. Step 6

    Cool 2 minutes. Slice into squares. Serve warm.

Tools you’ll need

  • sheet pan (9x13 inch)
  • vegetable peeler
  • sharp knife
  • medium bowl
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.