Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Pan-Fried Shrimp and Fish Dumplings with Peanut Sauce

Crispy golden dumplings filled with shrimp and white fish, served with a warm peanut-tamarind dipping sauce. Ready in 25 minutes with pantry staples and frozen wonton wrappers.

Total time
25 min
Servings
4
Calories
385
Protein
24g
Pan-Fried Shrimp and Fish Dumplings with Peanut Sauce
casualsatisfyingindonesianshrimpfishcrispytenderweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk peanut butter, tamarind paste, soy sauce, garlic, and 0.33 cup warm water in a bowl until smooth.

  2. Step 2

    Mix chopped shrimp and fish with a pinch of salt and pepper.

  3. Step 3

    Place 1 tsp filling in the center of each wonton wrapper. Wet edges with water, fold into a triangle, then bring corners together.

  4. Step 4

    Heat 3 tbsp oil in a large skillet over medium-high until shimmering, about 90 seconds.

  5. Step 5

    Pan-fry dumplings in batches 3 minutes per side until deep golden and crispy. Don't crowd the pan.

  6. Step 6

    Transfer to a plate lined with paper towels. Serve hot with peanut sauce for dipping.

Tools you’ll need

  • medium mixing bowl
  • whisk
  • 12-inch skillet
  • tongs
  • paper towels
  • small serving bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.