CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Pan-Fried Shrimp and Fish Dumplings with Peanut Sauce

Crispy golden dumplings filled with shrimp and white fish, served with a warm peanut-tamarind dipping sauce. Ready in 25 minutes with pantry staples and frozen wonton wrappers.

Total time
25 min
Servings
4
Calories
385
Protein
24g
Pan-Fried Shrimp and Fish Dumplings with Peanut Sauce
casualsatisfyingindonesianshrimpfishcrispytenderweeknight

Ingredients

  • ½ lb shrimp, peeled and finely chopped
  • ½ lb white fish fillet (cod or tilapia), finely chopped
  • 24 count wonton wrappers
  • ⅓ cup peanut butter
  • 2 tbsp tamarind paste (or lime juice)
  • 2 tbsp soy sauce
  • 1 count garlic clove, minced

Instructions

  1. 1

    Whisk peanut butter, tamarind paste, soy sauce, garlic, and 0.33 cup warm water in a bowl until smooth.

  2. 2

    Mix chopped shrimp and fish with a pinch of salt and pepper.

  3. 3

    Place 1 tsp filling in the center of each wonton wrapper. Wet edges with water, fold into a triangle, then bring corners together.

  4. 4

    Heat 3 tbsp oil in a large skillet over medium-high until shimmering, about 90 seconds.

  5. 5

    Pan-fry dumplings in batches 3 minutes per side until deep golden and crispy. Don't crowd the pan.

  6. 6

    Transfer to a plate lined with paper towels. Serve hot with peanut sauce for dipping.

Tools you’ll need

  • medium mixing bowl
  • whisk
  • 12-inch skillet
  • tongs
  • paper towels
  • small serving bowl

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.