Custrd is out on the App Store — Download it free →
Back to recipes

Black Tobiko Roll

A quick and elegant sushi roll filled with creamy avocado, fresh tuna, and crunchy black tobiko, wrapped in nori and served with lemon, ginger, and wasabi.

Total time
20 min
Servings
2
Calories
350
Protein
18g
Black Tobiko Roll
sophisticatedJapanesedairy-freefishchewycreamyweeknight dinnersushi

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cook 1 cup sushi rice according to package directions, then let cool slightly. Season with a pinch of salt and a splash of rice vinegar if you have it.

  2. Step 2

    Slice 1 avocado and 4 oz tuna into thin strips. Lay 1 nori sheet on a bamboo mat or clean surface, shiny side down.

  3. Step 3

    Spread half the rice evenly over the nori, leaving a 1 inch strip at the top. Sprinkle 1 tbsp black tobiko over the rice.

  4. Step 4

    Arrange half the avocado and tuna in a line across the center. Roll tightly, using the mat to press firmly, then seal the edge with a little water.

  5. Step 5

    Repeat with remaining ingredients. Slice each roll into 6 pieces with a sharp knife. Serve with lemon wedges, pickled ginger, and wasabi.

Tools you’ll need

  • bamboo sushi mat
  • sharp knife
  • small bowl of water

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.