Custrd is out on the App Store — Download it free →
Back to recipes

Tuna and Avocado Sushi Roll

A simple homemade sushi roll filled with fresh tuna and creamy avocado, wrapped in nori and seasoned rice. Perfect for a weeknight treat.

Total time
40 min
Servings
2
Calories
420
Protein
20g
Tuna and Avocado Sushi Roll
satisfyingfreshJapanesedairy-freefishchewycreamytender

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Rinse the 1 cup sushi rice in cold water until the water runs clear. Combine with 1.25 cups water in a pot and bring to a boil, then cover, reduce heat to low, and simmer until the water is absorbed and the rice is tender, about 15 minutes.

  2. Step 2

    While the rice cooks, mix 2 tbsp rice vinegar, 1 tsp sugar, and 0.5 tsp salt in a small bowl until dissolved. When the rice is done, let it rest 5 minutes, then fold in the vinegar mixture and spread the rice on a plate to cool to room temperature.

  3. Step 3

    Slice the 4 oz tuna into thin strips and the 1 avocado into thin slices. Have a small bowl of water nearby for dipping your fingers.

  4. Step 4

    Place a nori sheet shiny side down on a bamboo mat (or a sheet of plastic wrap). With wet fingers, spread half the rice evenly over the nori, leaving a 1-inch strip at the top edge bare.

  5. Step 5

    Arrange half the tuna and avocado in a line across the rice near the bottom edge. Roll the mat away from you, pressing gently to form a tight cylinder, and seal the bare edge with a little water.

  6. Step 6

    Repeat with the remaining nori, rice, tuna, and avocado. Slice each roll into 6 pieces with a sharp knife, wiping the blade between cuts. Serve with soy sauce, wasabi, or pickled ginger if you like.

  7. Step 7

    Enjoy your homemade sushi rolls immediately, or store in the fridge for up to a few hours.

Tools you’ll need

  • bamboo sushi mat
  • sharp knife
  • medium pot with lid
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.