Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Bruschetta Pomodoro

Toasted bread topped with fresh tomatoes, garlic, basil, and olive oil — a classic Italian appetizer or light dinner. Ready in 15 minutes.

Total time
15 min
Servings
4
Calories
185
Protein
4g
Bruschetta Pomodoro
freshsimpleitalianvegetariancrispyjuicyAppetizerweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice bread into 1/3-inch-thick diagonal pieces.

  2. Step 2

    Dice tomatoes into 1/2-inch pieces; place in a small bowl.

  3. Step 3

    Mince garlic and tear basil leaves by hand.

  4. Step 4

    Brush both sides of bread with 1.5 tbsp olive oil.

  5. Step 5

    Toast bread in a skillet over medium-high until golden, ~90 seconds per side.

  6. Step 6

    Rub each hot toast with a cut garlic clove until fragrant.

  7. Step 7

    Toss tomatoes with remaining 1.5 tbsp olive oil, basil, salt, and pepper.

  8. Step 8

    Spoon tomato mixture onto each toast and serve immediately.

Tools you’ll need

  • serrated knife
  • cutting board
  • small bowl
  • 12-inch skillet
  • brush or small spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.