Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Garlic Tomato Bruschetta

Crispy bread topped with bright, garlicky tomatoes and fresh basil. No cooking required — just toast, chop, and serve in under 10 minutes.

Total time
10 min
Servings
4
Calories
185
Protein
5g
Garlic Tomato Bruschetta
freshsimpleitalianvegetariancrispyjuicyAppetizerweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice bread diagonally into 0.5-inch-thick pieces. Arrange on a sheet pan.

  2. Step 2

    Broil 4 inches from heat until bread is golden and crisp, 2-3 minutes per side.

  3. Step 3

    Dice tomatoes into small chunks. Mince garlic and tear basil leaves.

  4. Step 4

    Toss tomatoes with garlic, basil, olive oil, vinegar, salt, and pepper.

  5. Step 5

    Spoon tomato mixture onto warm toast. Serve immediately.

Tools you’ll need

  • sheet pan
  • bread knife
  • cutting board
  • small bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.