CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Horiatiki — Greek Salad with Lemon & Oregano

Crisp tomatoes, cucumber, red onion, and creamy feta tossed with briny olives in a simple lemon-olive oil dressing. The true village salad—no lettuce, just pure Greek flavors ready in under 10 minutes.

Total time
8 min
Servings
2
Calories
385
Protein
11g
Horiatiki — Greek Salad with Lemon & Oregano
freshlightsimplegreekvegetariangluten-freecheesecrispy

Ingredients

  • 3 medium tomatoes (beefsteak or heirloom)
  • 1 large cucumber (English or Persian)
  • ½ medium red onion
  • 1 cup Kalamata olives (pitted)
  • 200 g feta cheese (crumbled)
  • 1 whole lemon (juiced)
  • 1 tsp dried oregano

Instructions

  1. 1

    Cut tomatoes into wedges. Chop cucumber into half-moons. Slice red onion into thin rings.

  2. 2

    In a large bowl, combine tomatoes, cucumber, onion, and olives. Add feta and toss gently.

  3. 3

    Drizzle with lemon juice and 3 tbsp olive oil. Sprinkle oregano and a pinch of salt.

  4. 4

    Toss one more time until dressed. Serve at room temperature with lemon water alongside.

Tools you’ll need

  • large mixing bowl
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.