Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Horiatiki — Greek Salad with Lemon & Oregano

Crisp tomatoes, cucumber, red onion, and creamy feta tossed with briny olives in a simple lemon-olive oil dressing. The true village salad—no lettuce, just pure Greek flavors ready in under 10 minutes.

Total time
8 min
Servings
2
Calories
385
Protein
11g
Horiatiki — Greek Salad with Lemon & Oregano
freshlightsimplegreekvegetariangluten-freecheesecrispy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut tomatoes into wedges. Chop cucumber into half-moons. Slice red onion into thin rings.

  2. Step 2

    In a large bowl, combine tomatoes, cucumber, onion, and olives. Add feta and toss gently.

  3. Step 3

    Drizzle with lemon juice and 3 tbsp olive oil. Sprinkle oregano and a pinch of salt.

  4. Step 4

    Toss one more time until dressed. Serve at room temperature with lemon water alongside.

Tools you’ll need

  • large mixing bowl
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.