Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Burrata Caprese Toast

Creamy burrata, juicy heirloom tomatoes, and fresh basil on crispy toast — no cooking required, just assembly. Ready in 5 minutes.

Total time
5 min
Servings
2
Calories
285
Protein
9g
Burrata Caprese Toast
lightsimplecalifornianvegetariancheesecreamycrispysnack

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toast the bread until edges are golden and centers still give slightly when pressed, about 2 minutes.

  2. Step 2

    Slice the heirloom tomatoes into 1/4-inch rounds.

  3. Step 3

    Tear the burrata into chunks and distribute evenly between the two toasts.

  4. Step 4

    Layer the tomato slices on top of the burrata, then scatter the basil leaves across.

  5. Step 5

    Drizzle with olive oil and season with salt and black pepper to taste. Serve immediately.

Tools you’ll need

  • toaster or toaster oven
  • cutting board
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.