Custrd is out on the App Store — Download it free →
Back to recipes

Cacio e Pepe

Three ingredients, twenty minutes, no cream. The Roman classic that lives or dies on emulsifying pecorino with starchy pasta water.

Total time
20 min
Servings
4
Calories
480
Protein
18g
Cacio e Pepe
pastaitalianvegetarianweeknightminimalist

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Bring a large pot of water to a boil. Salt it less than you normally would. Cook the spaghetti until just shy of al dente, about a minute less than the package time.

  2. Step 2

    While the pasta cooks, toast the cracked pepper in a dry wide skillet over medium heat for about a minute, until intensely fragrant. Add a ladle of pasta water to stop the toasting.

  3. Step 3

    Use tongs to transfer the pasta directly into the skillet along with another splash of pasta water. Toss vigorously over low heat for about a minute.

  4. Step 4

    Pull the pan off the heat. Sprinkle the pecorino over the pasta a small handful at a time, tossing constantly. Add splashes of pasta water as needed to keep things loose. The cheese should melt into a glossy, clinging sauce, not clump.

  5. Step 5

    Plate immediately. Top with a little extra pecorino and pepper if you like.

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.