Custrd is out on the App Store — Download it free →
Back to recipes

Calvados-style Tripe Stew

A quick, comforting tripe stew with onions and parsley, inspired by the classic Calvados preparation but simplified for a weeknight.

Total time
25 min
Servings
2
Calories
350
Protein
25g
Calvados-style Tripe Stew
comfortingFrenchgluten-freedairy-freetripetenderweeknightstew

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Rinse the 1 lb tripe and cut into bite-sized pieces. Slice the 1 medium onion thinly.

  2. Step 2

    Heat the 2 tbsp olive oil in a pot over medium heat. Add the onion and cook until soft and golden, about 5 minutes.

  3. Step 3

    Add the tripe and 2 cups chicken broth. Bring to a boil, then reduce heat to low and simmer until tripe is tender, about 15 minutes.

  4. Step 4

    Stir in the 1/4 cup chopped parsley and 1/2 tsp black pepper. Cook for 2 more minutes until fragrant.

  5. Step 5

    Serve hot, garnished with extra parsley if desired.

Tools you’ll need

  • pot
  • knife
  • cutting board
  • measuring cups
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.