CookSnap is in beta — Get it free on TestFlight →
Back to recipes

5-Min Margherita Flatbread

Toast a flatbread, spread it with marinara, tear fresh mozzarella on top, and finish with basil. Crispy-chewy, ready in 5 minutes — the weeknight pizza that doesn't need an oven.

Total time
5 min
Servings
2
Calories
380
Protein
14g
5-Min Margherita Flatbread
simplecasualitalianvegetariancrispymeltyweeknightpizza

Ingredients

  • 2 pieces flatbread
  • ½ cup marinara sauce
  • 8 oz fresh mozzarella
  • ¼ cup fresh basil

Instructions

  1. 1

    Heat a skillet over medium-high until a drop of water sizzles instantly.

  2. 2

    Toast each flatbread 90 seconds per side until the surface is lightly golden and edges crisp.

  3. 3

    Spread 2 tbsp marinara on each flatbread, then tear fresh mozzarella over the top.

  4. 4

    Return to the skillet for 60 seconds until the cheese starts to soften and melt.

  5. 5

    Scatter fresh basil leaves over the cheese and serve immediately.

Tools you’ll need

  • 12-inch skillet

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.