Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

5-Min Margherita Flatbread

Toast a flatbread, spread it with marinara, tear fresh mozzarella on top, and finish with basil. Crispy-chewy, ready in 5 minutes — the weeknight pizza that doesn't need an oven.

Total time
5 min
Servings
2
Calories
380
Protein
14g
5-Min Margherita Flatbread
simplecasualitalianvegetariancrispymeltyweeknightpizza

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat a skillet over medium-high until a drop of water sizzles instantly.

  2. Step 2

    Toast each flatbread 90 seconds per side until the surface is lightly golden and edges crisp.

  3. Step 3

    Spread 2 tbsp marinara on each flatbread, then tear fresh mozzarella over the top.

  4. Step 4

    Return to the skillet for 60 seconds until the cheese starts to soften and melt.

  5. Step 5

    Scatter fresh basil leaves over the cheese and serve immediately.

Tools you’ll need

  • 12-inch skillet

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.