Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Caramel Fish with Crispy Shallots

Vietnamese-inspired caramelized seafood in a glossy, salty-sweet sauce finished with crispy fried shallots. One skillet, zero fuss.

Total time
15 min
Servings
2
Calories
285
Protein
28g
Caramel Fish with Crispy Shallots
quickcasualvietnamesefishcrispytenderglossyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp oil in a 10-inch skillet over medium-high. Once shimmering, add sliced shallots and fry until golden brown and crispy, ~3 minutes. Transfer to a paper towel to cool.

  2. Step 2

    Add remaining 1 tbsp oil to the skillet. Lay fish chunks in a single layer without crowding; sear 2 minutes per side until golden, working in batches if needed.

  3. Step 3

    Push fish to the side. Sprinkle sugar directly into the empty pan and stir with a spoon until it melts and turns light amber, ~90 seconds.

  4. Step 4

    Pour soy sauce and water into the pan, stirring gently to coat the fish. Simmer 2 minutes until the sauce thickens and coats the fish with a gloss.

  5. Step 5

    Transfer fish and sauce to a serving plate. Top with crispy shallots and serve immediately with jasmine rice.

Tools you’ll need

  • 10-inch skillet with lid
  • wooden spoon
  • paper towels
  • serving plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.