CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Clay Pot Rice with Grilled Fish & Crispy Pancakes

Vietnamese street-style clay pot rice loaded with grilled fish, crispy banh xeo, and fresh herbs with a salty dipping sauce. All components cooked in parallel, ready in 20 minutes.

Total time
20 min
Servings
2
Calories
420
Protein
32g
Clay Pot Rice with Grilled Fish & Crispy Pancakes
casualsatisfyingvietnamesefishcrispytenderBreakfastweeknight

Ingredients

  • 2 cups cooked jasmine rice
  • ¾ lb fish fillets (sea bass or snapper)
  • 2 whole shallots, thinly sliced
  • 3 tbsp fish sauce
  • 2 tbsp lime juice
  • ½ cup fresh cilantro and mint, chopped
  • 2 whole scallions, sliced

Instructions

  1. 1

    Pat fish fillets dry. Season both sides generously with salt and pepper.

  2. 2

    Heat oil in a large skillet over medium-high until shimmering. Sear fish 3 minutes per side until skin is golden and flesh flakes easily.

  3. 3

    Transfer fish to a plate. In the same skillet, crisp shallots over medium heat, stirring, until golden brown and fragrant, about 4 minutes.

  4. 4

    Whisk fish sauce and lime juice together in a small bowl for dipping sauce. Set aside.

  5. 5

    Divide cooked rice between two bowls. Top each with a seared fish fillet, crispy shallots, cilantro, mint, and scallions.

  6. 6

    Serve immediately with the fish sauce and lime dipping sauce on the side.

Tools you’ll need

  • 12-inch nonstick or cast iron skillet
  • small mixing bowl
  • paper towels
  • two serving bowls
  • tongs or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.