Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Clay Pot Rice with Grilled Fish & Crispy Pancakes

Vietnamese street-style clay pot rice loaded with grilled fish, crispy banh xeo, and fresh herbs with a salty dipping sauce. All components cooked in parallel, ready in 20 minutes.

Total time
20 min
Servings
2
Calories
420
Protein
32g
Clay Pot Rice with Grilled Fish & Crispy Pancakes
casualsatisfyingvietnamesefishcrispytenderBreakfastweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat fish fillets dry. Season both sides generously with salt and pepper.

  2. Step 2

    Heat oil in a large skillet over medium-high until shimmering. Sear fish 3 minutes per side until skin is golden and flesh flakes easily.

  3. Step 3

    Transfer fish to a plate. In the same skillet, crisp shallots over medium heat, stirring, until golden brown and fragrant, about 4 minutes.

  4. Step 4

    Whisk fish sauce and lime juice together in a small bowl for dipping sauce. Set aside.

  5. Step 5

    Divide cooked rice between two bowls. Top each with a seared fish fillet, crispy shallots, cilantro, mint, and scallions.

  6. Step 6

    Serve immediately with the fish sauce and lime dipping sauce on the side.

Tools you’ll need

  • 12-inch nonstick or cast iron skillet
  • small mixing bowl
  • paper towels
  • two serving bowls
  • tongs or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.