Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Charred Kielbasa Sheet Pan with Peppers & Onions

Smoky grilled kielbasa with caramelized peppers, onions, and a punchy mustard-vinegar glaze. One sheet pan, 25 minutes, zero fuss.

Total time
25 min
Servings
4
Calories
485
Protein
28g
Charred Kielbasa Sheet Pan with Peppers & Onions
heartycasualpolishporkcrispytenderweeknightgame-day

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 450°F. Slice kielbasa on a diagonal into 1-inch-thick coins.

  2. Step 2

    Cut peppers into 1-inch chunks; slice onion into thick wedges. Toss with oil, salt, and pepper on a sheet pan.

  3. Step 3

    Scatter kielbasa coins over vegetables. Roast for 12–14 minutes until sausage edges char and vegetables soften.

  4. Step 4

    Whisk mustard, vinegar, caraway seeds, and a pinch of salt in a small bowl.

  5. Step 5

    Remove pan from oven. Drizzle glaze over kielbasa and vegetables; toss to coat.

  6. Step 6

    Serve hot straight from the pan with crusty bread or rye, if you like.

Tools you’ll need

  • sheet pan (18 x 13 inches)
  • small bowl
  • whisk
  • knife and cutting board
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.