Back to recipes
Crispy Tortilla Pizza
Flour tortillas become a thin, crackly crust in minutes. Top with pizza sauce and melted mozzarella, then broil until bubbly and golden.
- Total time
- 10 min
- Servings
- 2
- Calories
- 320
- Protein
- 14g
quickcasualamericanvegetariancrispymeltyweeknightpizza
Ingredients
3 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Place tortillas on a baking sheet and broil 2 minutes until lightly crisped.
Step 2
Spread 2 tbsp pizza sauce on each tortilla, leaving a thin edge.
Step 3
Top each with half the mozzarella, spread evenly.
Step 4
Broil 2–3 minutes until cheese melts and edges bubble.
Step 5
Slice and serve hot.
Tools you’ll need
- baking sheet
- broiler
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
