Custrd is out on the App Store — Download it free →
Back to recipes

Chicken Croquettes with Lettuce

Crispy golden chicken croquettes served on a bed of fresh lettuce with lime wedges for a bright, quick meal or snack.

Total time
20 min
Servings
4
Calories
320
Protein
28g
Chicken Croquettes with Lettuce
comfortingquickamericanchickencrispytenderweeknight dinnerparty

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    In a bowl, mix 2 cups shredded chicken, 1 beaten egg, 2 tbsp mayonnaise, and 1/2 cup breadcrumbs until well combined. Season with salt and pepper.

  2. Step 2

    Shape the mixture into 8 small croquettes, about 2 inches long. Roll each in the remaining 1/2 cup breadcrumbs to coat evenly.

  3. Step 3

    Heat 2 tbsp oil in a skillet over medium-high. Fry the croquettes in batches, turning occasionally, until golden brown and crispy on all sides, about 6-8 minutes total.

  4. Step 4

    Arrange 4 lettuce leaves on a plate and place the hot croquettes on top. Serve with lime wedges for squeezing over.

Tools you’ll need

  • mixing bowl
  • skillet
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.