Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Kajang Satay with Peanut Sauce

Grilled chicken and shrimp skewers glazed with a spiced peanut sauce, inspired by Malaysia's famous street satay. Ready in 20 minutes with a broiler or grill pan.

Total time
20 min
Servings
2
Calories
485
Protein
42g
20-Min Kajang Satay with Peanut Sauce
casualsatisfyingmalaysianchickenshrimptenderjuicyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Soak bamboo skewers in water for 10 minutes. Pat chicken or shrimp dry with paper towels.

  2. Step 2

    Thread chicken or shrimp onto skewers. Season both sides generously with salt and pepper.

  3. Step 3

    Whisk peanut butter, soy sauce, lime juice, chili paste, and 3 tbsp water until smooth and pourable.

  4. Step 4

    Heat a broiler or grill pan on high for 2 minutes. Lightly oil the surface.

  5. Step 5

    Broil or grill skewers 3 inches from heat, 3 minutes per side, until edges char slightly and centers cook through.

  6. Step 6

    Brush satay with peanut sauce on both sides during the last minute. Serve hot with extra sauce for dipping.

Tools you’ll need

  • 8 bamboo skewers
  • broiler pan or grill pan
  • whisk
  • small mixing bowl
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.