Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Chickpea Shiro Stew

A creamy, nutty Ethiopian chickpea flour stew served with injera or flatbread. Ready in under 10 minutes — no slow simmering required.

Total time
10 min
Servings
4
Calories
185
Protein
8g
Chickpea Shiro Stew
comfortheartyethiopianvegetarianveganchickpeascreamysmooth

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp olive oil in a large skillet over medium-high heat until shimmering, about 60 seconds.

  2. Step 2

    Add onion and cook, stirring often, until soft and translucent, about 3 minutes.

  3. Step 3

    Stir in garlic, ginger, and berbere; cook until fragrant, about 30 seconds.

  4. Step 4

    Whisk chickpea flour with 1 cup water until smooth, then pour into the skillet.

  5. Step 5

    Add remaining 2 cups water, stirring constantly to break up lumps. Bring to a simmer.

  6. Step 6

    Cook, stirring frequently, until the stew thickens and loses any raw flour taste, about 4 minutes. Season with salt and pepper.

Tools you’ll need

  • large skillet (12-inch)
  • wooden spoon
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.