Custrd is out on the App Store — Download it free →
Back to recipes

Chickpea Stew with Rice

A hearty one-pot stew with chickpeas, tomatoes, and peppers, served over fluffy rice with tender broccoli. Simple, satisfying, and ready in about 40 minutes.

Total time
40 min
Servings
4
Calories
420
Protein
15g
Chickpea Stew with Rice
comfortingweeknightspanishmediterraneanveganvegetariangluten-freedairy-free

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat the 2 tbsp olive oil in a large pot over medium. Add the 1 diced onion and 1 chopped green bell pepper; cook until soft, about 5 minutes.

  2. Step 2

    Add the 2 cans chickpeas (drained) and 1 can diced tomatoes with their juice. Stir in 1 tsp salt and bring to a simmer; cook for 10 minutes, until slightly thickened.

  3. Step 3

    Meanwhile, cook the 1 cup rice according to package directions, about 15 minutes, until tender.

  4. Step 4

    Steam the 2 cups broccoli florets in a steamer basket over boiling water for 4-5 minutes, until bright green and fork-tender.

  5. Step 5

    Serve the stew over the rice, topped with the broccoli. Add black pepper or a squeeze of lemon if you like.

  6. Step 6

    Stir in a pinch of smoked paprika or cumin for extra depth, if you have it.

Tools you’ll need

  • large pot
  • steamer basket
  • saucepan for rice
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.