Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Golden Fried Apple Hand Pies

Crispy fried pastry pockets stuffed with warm cinnamon-sugared apples, finished with a sweet glaze. A Southern classic that tastes like a fair treat and comes together in under 20 minutes.

Total time
18 min
Servings
4
Calories
385
Protein
3g
Golden Fried Apple Hand Pies
indulgentnostalgiccasualsouthernvegetariancrispyflakytender

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Peel, core, and finely dice the apples into 1/4-inch pieces. Toss with the cinnamon sugar.

  2. Step 2

    Roll out thawed puff pastry on a lightly floured surface. Cut into four 4-inch squares.

  3. Step 3

    Whisk powdered sugar with milk and vanilla until smooth for the glaze.

  4. Step 4

    Heat oil in a heavy pot to 350°F. Spoon 1 tbsp apple mixture onto half of each pastry square.

  5. Step 5

    Fold pastry in half to form a triangle. Press edges with a fork to seal, leaving no gaps.

  6. Step 6

    Fry hand pies 90 seconds per side until deep golden brown. Drain on paper towels.

  7. Step 7

    Drizzle warm hand pies generously with the glaze while still warm. Serve immediately.

Tools you’ll need

  • heavy-bottomed pot or deep skillet (3+ quart)
  • deep-fry thermometer
  • cutting board
  • chef's knife
  • fork (for sealing edges)
  • slotted spoon or spider skimmer
  • paper towels
  • small bowl for glaze

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.