Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Cinnamon Sugar Tortilla Chips

Crispy, sweet tortilla strips tossed in cinnamon and sugar—ready in 10 minutes with zero oven time. A satisfying snack that tastes like dessert.

Total time
10 min
Servings
2
Calories
180
Protein
2g
Cinnamon Sugar Tortilla Chips
simpleindulgentvegetariancrispysnacksnacksnackpan-fried

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Stack tortillas and cut into triangles using a knife or pizza cutter.

  2. Step 2

    Mix cinnamon and sugar in a small bowl.

  3. Step 3

    Heat oil in a skillet over medium-high until it shimmers, about 1 minute.

  4. Step 4

    Add tortilla triangles in a single layer and cook until edges curl and color deepens, 2–3 minutes per side.

  5. Step 5

    Transfer to a paper towel–lined plate while still warm.

  6. Step 6

    Sprinkle cinnamon-sugar mixture over hot chips and toss to coat evenly.

  7. Step 7

    Serve immediately while crispy.

Tools you’ll need

  • 12-inch skillet
  • cutting board
  • knife or pizza cutter
  • small bowl
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.