Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Classic Greek Salad

A bright, tangy Mediterranean salad with crisp vegetables, creamy feta, and briny olives tossed in a simple lemon-oregano dressing. Ready in 15 minutes with no cooking required.

Total time
15 min
Servings
4
Calories
285
Protein
8g
Classic Greek Salad
freshlightsimplegreekmediterraneanvegetariangluten-freecheese

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Hold a Roma tomato stem-side up on the cutting board and slice it straight down through the center from top to bottom into quarters, creating four wedge-shaped pieces; repeat with remaining tomatoes.

  2. Step 2

    Place the cucumber on the cutting board and slice it lengthwise from end to end into two long halves, then cut each half crosswise into half-moons about 1/4-inch thick—like coins.

  3. Step 3

    Cut the red onion in half from root to tip, place the flat side down on the cutting board, and slice it crosswise into thin half-rings about 1/8-inch wide, starting from one end.

  4. Step 4

    Pour the olive oil into a small bowl, then add 3 tablespoons of lemon juice and 1 teaspoon of dried oregano; whisk with a fork for 10 seconds until the mixture looks emulsified and uniform.

  5. Step 5

    Add the tomato wedges, cucumber slices, and red onion rings to a large bowl, then scatter the Kalamata olives and crumbled feta cheese on top.

  6. Step 6

    Pour the lemon-oregano dressing over the salad, then toss everything together with two large spoons or salad forks, turning and lifting until the dressing coats all the vegetables and cheese evenly.

  7. Step 7

    Taste the salad, then sprinkle with salt and pepper a pinch at a time until it tastes the way you like it—not too salty, as the feta and olives already add saltiness.

Tools you’ll need

  • cutting board
  • chef's knife
  • small mixing bowl
  • fork
  • large serving bowl
  • salad forks or large spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.