Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Greek Village Salad

Crisp tomatoes, cucumbers, olives, and creamy feta tossed with a punchy olive-oil-and-vinegar dressing. This is the real deal—no lettuce, just the good stuff.

Total time
15 min
Servings
4
Calories
285
Protein
8g
Greek Village Salad
freshlightsimplegreekmediterraneanvegetariangluten-freecheese

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut tomatoes into chunks, removing excess seeds. Cut cucumber into half-moons.

  2. Step 2

    Thinly slice the red onion and place in a large bowl with tomatoes, cucumber, and olives.

  3. Step 3

    Whisk olive oil and red wine vinegar in a small bowl. Add a pinch of salt and black pepper.

  4. Step 4

    Pour dressing over salad and toss gently to coat, about 20 times.

  5. Step 5

    Top with crumbled feta cheese and a crack of black pepper. Serve immediately.

Tools you’ll need

  • cutting board
  • chef's knife
  • large bowl
  • small bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.