Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Com Rang Thap Cam — Mixed Fried Rice with Crispy Egg

Vietnamese mixed fried rice studded with shrimp, ham, and peas, topped with a crispy fried egg and served with cucumber, tomato, and a savory dipping sauce. Total flavor and texture in under 20 minutes.

Total time
18 min
Servings
2
Calories
485
Protein
28g
Com Rang Thap Cam — Mixed Fried Rice with Crispy Egg
satisfyingquickvietnameseshrimpeggscrispyfluffyweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over high heat. When shimmering, add shrimp and ham; cook 2 minutes until shrimp turns pink.

  2. Step 2

    Add rice and peas, breaking up clumps with a spoon. Stir constantly until rice separates and grains are lightly golden, 3 minutes.

  3. Step 3

    Pour fish sauce over the rice. Toss until evenly coated. Add scallions and stir for 30 seconds until fragrant.

  4. Step 4

    Transfer fried rice to a plate. Add 1 tbsp oil to the skillet and crack both eggs into it. Fry until whites set but yolks still jiggle.

  5. Step 5

    Slide the crispy-edged eggs onto the rice. Serve with lime wedges, cucumber slices, and tomato wedges on the side.

Tools you’ll need

  • large skillet (12-inch)
  • spoon or spatula
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.