Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Mixed Fried Rice with Chili Oil

Vietnamese-style fried rice loaded with shrimp, chicken, and egg, topped with crispy fried noodles and a hit of chili oil. Ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
620
Protein
38g
Crispy Mixed Fried Rice with Chili Oil
satisfyingquickvietnameseshrimpchickeneggscrispyfluffy

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over high heat until smoking, about 90 seconds.

  2. Step 2

    Add diced chicken and cook, stirring, until no pink remains, about 4 minutes.

  3. Step 3

    Push chicken to the side. Add shrimp to the empty space and cook until pink, stirring occasionally, about 3 minutes.

  4. Step 4

    Add minced garlic and cook, stirring constantly, for 30 seconds until fragrant.

  5. Step 5

    Crack eggs into the skillet, scramble quickly, breaking yolks, until just cooked through, about 2 minutes.

  6. Step 6

    Add chilled rice and soy sauce. Stir constantly, breaking up clumps, for 3 minutes until rice is hot and coated.

  7. Step 7

    Drizzle chili oil over the top and fold in gently. Transfer to a plate.

  8. Step 8

    Top with crispy fried noodles and serve immediately while rice is still steaming.

Tools you’ll need

  • large skillet or wok (12+ inches)
  • wooden spoon or spatula
  • measuring spoons
  • measuring cups

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.