Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Com Rang Thap Cam — Mixed Fried Rice with Lime

Vietnamese mixed fried rice loaded with egg, shrimp, and char-edged rice, finished with a squeeze of lime and crisp cucumber. Fast, savory, and completely crave-able in under 20 minutes.

Total time
18 min
Servings
2
Calories
380
Protein
18g
Com Rang Thap Cam — Mixed Fried Rice with Lime
quicksatisfyingvietnameseshrimpeggscrispytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 2 tbsp oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  2. Step 2

    Add shrimp and cook without stirring for 90 seconds until starting to pink on the bottom.

  3. Step 3

    Stir and cook shrimp another 60 seconds until fully opaque, then push to the side of the skillet.

  4. Step 4

    Crack eggs into the cleared space and scramble until just set, about 90 seconds.

  5. Step 5

    Add rice, breaking up clumps, then pour soy sauce over and toss everything together until heated through, 2–3 minutes.

  6. Step 6

    Serve hot with sliced cucumber on the side and a lime wedge for squeezing.

Tools you’ll need

  • 14-inch skillet or wok
  • spatula
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.