Custrd is out on the App Store — Download it free →
Back to recipes

Creamed Fish Fillet

A quick and comforting skillet dish of tender fish fillets simmered in a creamy onion sauce, finished with fresh parsley. Ready in about 20 minutes, perfect for a weeknight dinner.

Total time
20 min
Servings
4
Calories
380
Protein
32g
Creamed Fish Fillet
comfortingamericangluten-freefishtendercreamyweeknightmain course

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the 1.5 lb fish fillets dry and season both sides with salt and pepper. Set aside.

  2. Step 2

    In a large skillet, melt the 2 tbsp butter over medium heat. Add the 1 sliced onion and cook until soft and golden, about 5 minutes.

  3. Step 3

    Pour in the 1 cup heavy cream and bring to a gentle simmer. Cook until slightly thickened, about 2 minutes.

  4. Step 4

    Add the fish fillets to the skillet, spooning some sauce over them. Cover and cook until fish is opaque and flakes easily, about 8 minutes.

  5. Step 5

    Sprinkle with the 2 tbsp chopped parsley and serve hot.

Tools you’ll need

  • large skillet
  • spatula
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.