Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Turkish Lahmacun with Ayran & Lemon

Crispy, thin beef flatbreads topped with garlicky spiced meat, served with cooling yogurt drink, fresh salad, and lemon. A complete weeknight dinner that tastes like it took hours but comes together in under 30 minutes.

Total time
28 min
Servings
2
Calories
520
Protein
22g
Turkish Lahmacun with Ayran & Lemon
casualsatisfyingmiddle-easternbeefcrispytenderweeknightdinner

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour with 0.5 cup warm water and a pinch of salt until a soft dough forms. Knead 2 minutes, cover, let rest while you prep the meat.

  2. Step 2

    Brown ground beef in a skillet over medium-high heat, breaking it up with a spoon, about 4 minutes. Drain excess fat if needed.

  3. Step 3

    Add garlic and red pepper flakes, cook 30 seconds until fragrant. Stir in tomato paste and 2 tablespoons water, simmer 2 minutes. Season with salt and pepper.

  4. Step 4

    Divide dough in half. Roll each into a thin oval about 6 inches long on a floured surface. Place on a greased baking sheet.

  5. Step 5

    Spread beef mixture evenly over each dough oval. Bake at 475°F for 6–8 minutes until crust is golden and crispy at the edges.

  6. Step 6

    Whisk yogurt with 0.5 cup cold water and a pinch of salt to make ayran. Serve lahmacun with ayran, fresh salad, and lemon wedges.

Tools you’ll need

  • medium bowl
  • 12-inch skillet
  • baking sheet
  • rolling pin
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.