Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Cheese & Herb Sigara Borek

Thin phyllo pastry rolled with salty feta and fresh herbs, pan-fried until golden and crispy. A classic Turkish breakfast that's ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
385
Protein
11g
Crispy Cheese & Herb Sigara Borek
simplecrispyturkishvegetariancheesecrispyflakybreakfast

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix feta, parsley, dill, and black pepper in a small bowl until combined.

  2. Step 2

    Lay one phyllo sheet on a cutting board. Brush lightly with melted butter.

  3. Step 3

    Place 2 tbsp filling 1 inch from the bottom edge, leaving 1 inch on each side.

  4. Step 4

    Fold the left and right edges inward to cover 1 inch of filling on each side.

  5. Step 5

    Roll tightly away from you into a cigar shape. Repeat with remaining phyllo.

  6. Step 6

    Heat 2 tbsp butter in a large skillet over medium-high until it foams.

  7. Step 7

    Pan-fry 4 borek 3 minutes per side until golden brown and crispy, then set aside.

  8. Step 8

    Add remaining 2 tbsp butter and pan-fry the final 4 borek 3 minutes per side.

  9. Step 9

    Serve warm with a squeeze of lemon juice if desired.

Tools you’ll need

  • cutting board
  • small mixing bowl
  • 12-inch skillet
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.