Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Cheese & Herb Sigara Boreks

Golden, paper-thin phyllo rolls stuffed with feta, fresh herbs, and spinach, fried until crunchy. A Turkish breakfast showstopper that's ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
420
Protein
12g
Crispy Cheese & Herb Sigara Boreks
rusticsatisfyingturkishvegetariancheesecrispyflakybreakfast

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix feta, spinach, parsley, and dill in a bowl. Season with black pepper.

  2. Step 2

    Lay one phyllo sheet on a cutting board. Brush lightly with melted butter.

  3. Step 3

    Spoon 2 tbsp filling near the bottom edge. Fold bottom corner up, then roll tightly into a cigar shape, tucking in the sides as you go.

  4. Step 4

    Repeat with remaining phyllo sheets and filling. You should have 8 boreks.

  5. Step 5

    Heat oil in a medium skillet over medium-high until a phyllo edge sizzles instantly on contact, about 2 minutes.

  6. Step 6

    Fry boreks 90 seconds per side until deep golden brown and crispy. Work in batches if needed to avoid crowding.

  7. Step 7

    Transfer to a paper towel–lined plate. Serve hot with lemon wedges or yogurt if desired.

Tools you’ll need

  • large mixing bowl
  • cutting board
  • medium skillet (10–12 inch)
  • slotted spoon or tongs
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.