Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Cheese Puff Pastry Bake

Swiss chäschüechli reimagined as a 15-minute sheet-pan bake: puff pastry squares topped with melted Gruyère, sharp mustard, and a crack of pepper. Golden, gooey, and dangerously easy.

Total time
15 min
Servings
4
Calories
385
Protein
12g
Crispy Cheese Puff Pastry Bake
indulgentquickswissvegetariancheesecrispyflakygooey

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Line a sheet pan with parchment paper.

  2. Step 2

    Cut thawed pastry into 16 squares. Arrange on the sheet pan, spacing 1 inch apart.

  3. Step 3

    Brush each square lightly with egg wash. Top with 1.5 tbsp Gruyère and 0.5 tsp mustard per square.

  4. Step 4

    Sprinkle with black pepper and salt. Bake 10-12 minutes until pastry is puffed and golden.

  5. Step 5

    Cool 2 minutes on the pan. Serve hot, cheese still melting.

Tools you’ll need

  • sheet pan
  • parchment paper
  • knife
  • small bowl
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.