CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Sheet-Pan Fatayer — Lebanese Spinach & Cheese Pastries

Crispy, golden phyllo triangles stuffed with spinach, feta, and sumac — baked on one sheet pan in 18 minutes. Serve warm with lemon for the ultimate TikTok-easy Lebanese dinner.

Total time
20 min
Servings
4
Calories
285
Protein
8g
Sheet-Pan Fatayer — Lebanese Spinach & Cheese Pastries
casualfreshlebanesevegetariancheesecrispyflakyweeknight

Ingredients

  • 10 oz frozen spinach, thawed and squeezed dry
  • ¾ cup feta cheese, crumbled
  • 12 sheets phyllo dough sheets
  • ¼ cup olive oil
  • ½ tsp sumac
  • 1 whole lemon
  • 1 pinch salt and black pepper to taste

Instructions

  1. 1

    Mix spinach, feta, sumac, salt, and pepper in a bowl until combined.

  2. 2

    Lay one phyllo sheet on a work surface and brush lightly with olive oil.

  3. 3

    Spoon 1 tbsp filling onto one corner, then fold the sheet diagonally twice to form a triangle. Repeat with remaining phyllo and filling.

  4. 4

    Arrange triangles on a sheet pan and brush each lightly with remaining olive oil.

  5. 5

    Bake at 400°F for 15–18 minutes until edges are deep golden and crispy.

  6. 6

    Serve warm with lemon wedges squeezed over the top.

Tools you’ll need

  • mixing bowl
  • work surface
  • sheet pan
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.