Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Sheet-Pan Fatayer — Lebanese Spinach & Cheese Pastries

Crispy, golden phyllo triangles stuffed with spinach, feta, and sumac — baked on one sheet pan in 18 minutes. Serve warm with lemon for the ultimate TikTok-easy Lebanese dinner.

Total time
20 min
Servings
4
Calories
285
Protein
8g
Sheet-Pan Fatayer — Lebanese Spinach & Cheese Pastries
casualfreshlebanesevegetariancheesecrispyflakyweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix spinach, feta, sumac, salt, and pepper in a bowl until combined.

  2. Step 2

    Lay one phyllo sheet on a work surface and brush lightly with olive oil.

  3. Step 3

    Spoon 1 tbsp filling onto one corner, then fold the sheet diagonally twice to form a triangle. Repeat with remaining phyllo and filling.

  4. Step 4

    Arrange triangles on a sheet pan and brush each lightly with remaining olive oil.

  5. Step 5

    Bake at 400°F for 15–18 minutes until edges are deep golden and crispy.

  6. Step 6

    Serve warm with lemon wedges squeezed over the top.

Tools you’ll need

  • mixing bowl
  • work surface
  • sheet pan
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.